Welcome to Everychina Market!
Carbon Black Manufactures, Carbon Black Suppliers from China
  • Verified Supplier
Hot China Products: 
Lighting Agents, Lighting Accessories, Other Lights & Lighting Products | More ... Lighting Bulbs & TubesSupplies and EquipmentOther Electronic ComponentsPassive Components
Home PageChemicals

Carbon Black

China Categories
1 - 20 Results for Carbon Black from 937 Products
CAS 59-30-3 Pharmaceutical Powder USP Folic Acid for Hematopoietic Quick Detail: Product Name Folic acid Alias Pteroylmonoglutamic Acid ; CAS NO 59-30-3 MF C19H19N7O6 MW 441.4 EINECS 200-419-0 Purity 99% Appearance orange to yellow crystalline powder ... Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplierlicense Verified
Sodium Carbonate / Soda Ash Dense for Making Food , Bread , Biscuit Descriptions Appearance White powder or fine crystals Iron(Fe2O3) 0.004%max Ignition Loss 0.8%max Bulk Density 0.9g/ml min Product Details Item Soda Ash Dense Index Total alkali(quality ... Weifang Duojiao Chemical Co.,ltd
Verified Supplierlicense Verified
1.Basic Info. Product Name: alpha-(2,4-Dichlorophenyl)-1H-imidazole-1-ethanol Synonyms:1-(2,4-DICHLOROPHENYL)-2-(1H-IMIDAZOL-1-YL)ETHANOL;1-(2,4-dichlorophenyl)-2-(1-imidazolyl)ethanol;1-(2,4-DICHLOROPHENYL)-2-IMIDAZOL-1-YL ETHANOL; MF: C11H10Cl2N2O MW: ... Guangzhou Kafen Biotech Co.,Ltd
Verified Supplierlicense Verified
detergent speckles sodium sulphate colorful speckles for washing powder We are a professional manufacturer of detergent color speckle. And we can provide kinds of color speckles according to customer's requirements, including the color, shape, particle ... Keenpoint Technology Industry Limited
Verified Supplierlicense Verified
...Mole Ratio: 30-300 Nominal Cation Form: Sodium/Hydrogen Na2O Weight %: 0.05 Surface Area, m2/g: 340 ZSM-12 molecular sieve due to the unique pore structure and ... Zibo  Jiulong  Chemical  Co.,Ltd
Verified Supplierlicense Verified
Oral Anabolic Steroids Male Enhancement Powder Mesterolone / Proviron CAS 1424-00-6 Quick Details: CAS: 1424-00-6 Synonyms: 17-beta-hydroxy-1-alpha-methyl-5-alpha-androstan-3-on; 1-alpha-methyl-17-beta-hydroxy-5-alpha-androstan-3-one; Androviron; ... zhuhai TianJian Chemical Co.,Ltd.
Verified Supplierlicense Verified
High-class Coal Tar Pitch in Large Quantity 1.Description: Coal Tar Pitch is a kind of black block with brittleness and odor , which is lustrous at normal temperature. It is poisonous and can be easily flamed when melting, and it belongs to second-grade ... Handan Jinghao Chemical Co., Ltd
Verified Supplierlicense Verified
Nandrolone phenylpropionate 62-90-8 White Steroid Powder For Inoperable Breast Cancer Basic information: Product Name: Nandrolone phenylpropionate Synonyms: NANDROLONE PHENPROPIONATE;NANDROLONE PHENYLPROPIONATE;NANDROLONI PHENYLPROPIONAS;17-(1-oxo-3-... Shenzhen Keray Biotech Co., Ltd.
Verified Supplierlicense Verified
Stanozolol Raw Steroid Powders Winstrol CAS:10418-03-8 top quality Product Name: Stanozolol Alias: Winstrol;Stanazol CAS No.: 10418-03-8 Molecular Formula: C21H32N2O Molecular Weight: 328.49 Purity: ≥98% Appearance: White Crystaline Powder. Use: Used to... Hubei KUKE Chemcial Co., Ltd
Verified Supplierlicense Verified
Product Description titanium dioxide anatase /rutile Tio2 Titanium dioxide pigment (TiO2) is a white powder with high dispersibility, brilliant whiteness, excellent covering power and resistance.The product is a kind of white powder which is safe, ... Changsha Lianda Chemical Co., Ltd.
Verified Supplierlicense Verified
Research peptide FOXO4 peptide / FOXO4-DRI / Senolytics with 98% min For anti-aging and longevity FOXO4 D-Retro-Inverso(DRI) peptide MS/HPLC Reports MS Report HPLC Report Quantity/Unit 1 Vial Sequence H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH ... HANGZHOU MOBEL BIOTECHNOLOGY CO.,LTD
Verified Supplierlicense Verified
CAS 76-43-7 Fluoxymesterone Product name: Fluoxymesterone,Halotestin,Android-F CAS register number: 76-43-7 EINECS : 200-961-8 Molecular formula: C20H29FO3 Molecular weight : 336.44 Melting point: 240 °C Assay: 99% min Grade:Pharmaceutical Grade Most ... Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplierlicense Verified
ZrO2 Zirconia Silicate Beads For Grinding , Zirconia Ceramic Balls ISO9001 Product Description ZrO2 Zirconia Oxide silicate Ball for grinding Item Unit Specification Composition wt% 94.5% ZrO2 5.2% Y2O3 Bulk Density Kg/L >3.6(Φ2mm) Specific Density g/cm3... Chaozhou Fengye Industrial Co.,Ltd.
Verified Supplierlicense Verified
YUANHANG Trenbolone Series Powder Trenbolone Hexahydrobenzyl Carbonate For Muscle Building 23454-33-3 Basic Information Name: Estra-4,9,11-trien-3-one,17-[[(cyclohexylmethoxy)carbonyl]oxy]-, (17b)- CAS No.:23454-33-3 Molecular Structure: Formula: C26H34O4... Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplierlicense Verified
legal muscle building Peptides Triptorelin CAS57773-63-4 human growth Peptides​ Related Peptides Description: 1. CJC-1295 is a derivative of human GH-releasing factor1-29(HGRF1-29). HGRF1-29 is a naturally occurring peptide that is actually a truncated ... HONGKONG RONGXIN BIO-TECH CO.,LTD
Verified Supplierlicense Verified
Alkaline Protease (Powder) for Leather & Silk Processing Declared Enzyme: Protease Systematic Name: EC 3.4.21.62 Appearance: Light brown powder Activity: 250,000 U/g(Minimum) Moisture: 8% (Maximum) PRODUCT DESCRIPTION Alkaline protease JP-25 is a powder ... Jiangsu Boli Bioproducts Co., Ltd.
Verified Supplierlicense Verified
Detergent Anionic Surfactant 151-21-3 92 Sodium Lauryl Sulfate SLS K12​ EP-SLS92 INCI Name & CAS No. Sodium Lauryl Sulfate 151-21-3 Description Product name: Sodium Lauryl Sulfate (SLS) Molecular Formula:CH3(CH2)11OSO3Na Molecular Weight:288.38 CAS No:... EHLP SCIENCE & TECHNOLOGY CORPORATION
Verified Supplierlicense Verified
Echinacea Purpurea Extract 4% Polyphenol 2% 4% Cichoric Acid Powder Name: Echinacea Purpurea extract Latin Name: Echinacea Purpurea (L.) Moench Specification: 4%Polyphenols; 2% -4% Cichoric acid Part used: Aerial part Extraction Type: Solvent Extraction ... Changsha World-Way Biotech Inc
Verified Supplierlicense Verified
MnCO3 manganese carbonate dry & wet powder Mn 43.5 % from manganese carbonate powder feed grade mixed inorganic compound fertilizer for animal &plant Manganese carbonate is a brown solid with the chemical formula MnCO3. Its IUPAC name is Manganese(II) ... Ningbo Sourcechem Co.,Ltd
Verified Supplierlicense Verified
Various Embossing Pattern Hand Tear Off Tape For Cosmetics And Cigarette Packaging Character: 1. Environmental friendly which accords with superior Packing Material Standard. 2. With a strong backing and an aggressive adhesive that provides a secure and ... Guangzhou Binhao Technology Co., Ltd
Verified Supplierlicense Verified
Page 1 of 5 :   |< << 1 2 3 4 5 >> >|